Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein L801

UniProt

Q5UR61

Expression Region

1-131

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNKRYNPDVVIDFGVDFSNDYNKSKNKFFDRYIIFNKDFMKYIFKLALRALIMIGIIEL SYFISLGGFYLVSNDPIYFRNLSIFHARGVEFATECSDIISIFCSIAFVLFCIYDVGKYY VTKCKSSKRYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL32 antibody
PAab04270 100 µg

Anti-IL32 antibody

Sign In for Pricing
View Details
3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid
OR1028360-01 100 mg

3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid

Sign In for Pricing
View Details
3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid
OR1028360-02 250 mg

3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid

Sign In for Pricing
View Details
3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid
OR1028360-03 1 g

3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid

Sign In for Pricing
View Details
3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid
OR1028360-04 5 g

3,5-Bis (Ethoxycarbonyl) -2,6-Dimethyl-1,4-Dihydropyridine-4-Carboxylic Acid

Sign In for Pricing
View Details
Anti-ATP6V0C / VATL Antibody (aa100-126) IHC-plus
MBS2400023-01 0.2 mL

Anti-ATP6V0C / VATL Antibody (aa100-126) IHC-plus

Sign In for Pricing
View Details