Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C4orf32 homolog

This Recombinant Mouse Uncharacterized protein C4orf32 homolog spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein C4orf32 homolog

UniProt

Q9CZL2

Expression Region

1-131

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCSARKLLRGGAGSAGGECDEDGAAPAGRVEEPEHGASPRRRRPQDEGEQDIEEPQNHSG EPIGDDYKKMGTLFGELNKNLLNMGFTRMYFGERIVEPVVVLFFWLMLWFLGLQALGLVA VLCLVIIYVQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182C-01 50 Tests

FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182C-02 100 Tests

FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]
E-AB-F1182C-03 2x 100 Tests

FITC Anti-Mouse CD335/NKp46 Antibody[29A1.4]

Sign In for Pricing
View Details
Wwp2 Mouse Gene Knockout Kit (CRISPR)
KN519479 1 Kit

Wwp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alizarin Yellow R, Sodium Salt
TRC-A358505-25G 25 g

Alizarin Yellow R, Sodium Salt

Sign In for Pricing
View Details
CD163 Recombinant Rabbit monoclonal Antibody
HA750412 100 µL

CD163 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details