Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit C (frdC)

This Recombinant Fumarate reductase subunit C (frdC) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Fumarate reductase subunit C, Fumarate reductase 15 kDa hydrophobic protein

UniProt

P20923

Expression Region

1-131

Origin

Proteus vulgaris

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTKRKPYVRGMQPNWWTKLGFYRFYITREGTCLPQLWFSLVVLFGVFALKNGPESWAGF VGFLSNPILMLINIVTLIATVFHTATWFKLAPKAVNIVVKDEKLPQEPIVRGLWGLTIVV TVVILAVALIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-100 1x 100 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF647 conjugate, 0.1mg/mL
BNC470763-500 1x 500 µL

CD34 (HPCA1/763), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF647 conjugate, 0.1mg/mL
BNC471974-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/1097), CF740 conjugate, 0.1mg/mL
BNC741097-100 1x 100 µL

CD44 Standard (HCAM/1097), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF594 conjugate, 0.1mg/mL
BNC941448-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1448), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details