Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yxeC (yxeC)

This Recombinant Bacillus subtilis Uncharacterized protein yxeC (yxeC) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Uncharacterized protein yxeC

UniProt

P54942

Expression Region

1-132

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGITKRGAAWEWLHSWWMLFIFMPFAITSFFAFLFIGIKVRNRKWIMYGIIYFFIFAFGF VLPDLPGVFIVVPLWAVTIIHGFKVRPLYLIQLDVYKDHVEARAFAEARSEAESRFHAPK QSIQDIHIRKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf58 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E9]
TA808863AM 100 µL

C17orf58 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6E9]

Sign In for Pricing
View Details
FITC Conjugated Human CD3 Recombinant Mouse Monoclonal Antibody [PSH04-92]
HA600116F 100 µL

FITC Conjugated Human CD3 Recombinant Mouse Monoclonal Antibody [PSH04-92]

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2808R), CF740 conjugate, 0.1mg/mL
BNC742808-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2808R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM58 (NM_015431) Human Over-expression Lysate
LC402434 20 µg

TRIM58 (NM_015431) Human Over-expression Lysate

Sign In for Pricing
View Details
ZC3H8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B12]
TA808242BM 100 µL

ZC3H8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B12]

Sign In for Pricing
View Details
REPS2 (NM_001080975) Human Over-expression Lysate
LC421142 20 µg

REPS2 (NM_001080975) Human Over-expression Lysate

Sign In for Pricing
View Details