Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yxeC (yxeC)

This Recombinant Bacillus subtilis Uncharacterized protein yxeC (yxeC) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Uncharacterized protein yxeC

UniProt

P54942

Expression Region

1-132

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGITKRGAAWEWLHSWWMLFIFMPFAITSFFAFLFIGIKVRNRKWIMYGIIYFFIFAFGF VLPDLPGVFIVVPLWAVTIIHGFKVRPLYLIQLDVYKDHVEARAFAEARSEAESRFHAPK QSIQDIHIRKEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QA / Complement C1q A-Chain (C1QA/2953), CF568 conjugate, 0.1mg/mL
BNC682953-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2953), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
11-Bromoundecanoic Acid
TRC-B688880-25G 25 g

11-Bromoundecanoic Acid

Sign In for Pricing
View Details
5-O-Coumaroylquinic Acid
TRC-C899975-50MG 50 mg

5-O-Coumaroylquinic Acid

Sign In for Pricing
View Details
Fenvalerate
TRC-F279450-50MG 50 mg

Fenvalerate

Sign In for Pricing
View Details
Recombinant Phospho-S6 Ribosomal Protein (Ser235, Ser236) Monoclonal Antibody
AN302091L-01 50 µL

Recombinant Phospho-S6 Ribosomal Protein (Ser235, Ser236) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-S6 Ribosomal Protein (Ser235, Ser236) Monoclonal Antibody
AN302091L-02 100 µL

Recombinant Phospho-S6 Ribosomal Protein (Ser235, Ser236) Monoclonal Antibody

Sign In for Pricing
View Details