Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus anthracis Large-conductance mechanosensitive channel (mscL)

This Recombinant Bacillus anthracis Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

C3L9Y0

Expression Region

1-132

Origin

Bacillus anthracis (strain CDC 684 / NRRL 3495)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNEFKKFAFKGNVIDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTDLKITFG KSSIMYGNFIQTIFDFLIIAAAIFMFVKVFNKLTSKREEEKEEEIPEPTKEEELLGEIRD LLKQQNSSKDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF488A conjugate, 0.1mg/mL
BNC882289-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF488A conjugate, 0.1mg/mL
BNC880035-500 1x 500 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF405S conjugate, 0.1mg/mL
BNC040774-100 1x 100 µL

HSP27 (HSPB1/774), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details