Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus sakei subsp. sakei Large-conductance mechanosensitive channel (mscL)

This Recombinant Lactobacillus sakei subsp. sakei Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q38V39

Expression Region

1-132

Origin

Lactobacillus sakei subsp. sakei (strain 23K)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKEFKEFIMRGNVLDMAVGVILGAALKSIVDSLTKNLINPIISLFVGQVDLSGIAVTIP GTKAVFQIGNFLNDVINFLIIAIIVFLIVKGFNKLRDMGKKTEEEVAEEAAPTQEELYLK EIRDLLANKDHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-500 1x 500 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Luteinizing Hormone beta (LH beta) (LHb/1214), CF488A conjugate, 0.1mg/mL
BNC881214-100 1x 100 µL

Luteinizing Hormone beta (LH beta) (LHb/1214), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details