Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Large-conductance mechanosensitive channel (mscL)

This Recombinant Bacillus cereus Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q816Z0

Expression Region

1-132

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNEFKKFAFKGNVVDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTSLHFGYG KSAVMYGNFIQTIFDFLIIAASIFMFVKVFNKLTSKKEEEKEEEIPEPTKEEELLGEIRD LLKQQNSSKDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL
BNC880745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), CF647 conjugate, 0.1mg/mL
BNC470010-100 1x 100 µL

MART-1 / Melan-A (M2-9E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM452), CF568 conjugate, 0.1mg/mL
BNC680452-100 1x 100 µL

Vimentin (VM452), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (SPN/839), CF488A conjugate, 0.1mg/mL
BNC880839-500 1x 500 µL

CD43 (SPN/839), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details