Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5)

This Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 5, Bone-restricted interferon-induced transmembrane protein-like protein, BRIL

UniProt

A6NNB3

Expression Region

1-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA FFSTKFDDADYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPO, CT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 405) discontinued
038563-ML405 100 µL

MPO, CT (MPO, Myeloperoxidase, 89kD myeloperoxidase, 84kD myeloperoxidase, Myeloperoxidase light chain, Myeloperoxidase heavy chain) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ERCC1 Recombinant Rabbit mAb
BS47010-01 50 µL

ERCC1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
ERCC1 Recombinant Rabbit mAb
BS47010-02 100 µL

ERCC1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein KIAA1704 homolog
MBS1436038-01 0.02 mg (E-Coli)

Recombinant Pongo abelii Uncharacterized protein KIAA1704 homolog

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein KIAA1704 homolog
MBS1436038-02 0.02 mg (Yeast)

Recombinant Pongo abelii Uncharacterized protein KIAA1704 homolog

Sign In for Pricing
View Details
Recombinant Pongo abelii Uncharacterized protein KIAA1704 homolog
MBS1436038-03 0.1 mg (E-Coli)

Recombinant Pongo abelii Uncharacterized protein KIAA1704 homolog

Sign In for Pricing
View Details