Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5)

This Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 5, Bone-restricted interferon-induced transmembrane protein-like protein, BRIL

UniProt

A6NNB3

Expression Region

1-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA FFSTKFDDADYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1305089 (NM_001106730) Rat Tagged ORF Clone Lentiviral Particle
RR214496L4V 200 µL

RGD1305089 (NM_001106730) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)
TMPH-00671-01 5 µg

Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)

Sign In for Pricing
View Details
Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)
TMPH-00671-02 10 µg

Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)

Sign In for Pricing
View Details
Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)
TMPH-00671-03 20 µg

Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)

Sign In for Pricing
View Details
Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)
TMPH-00671-04 50 µg

Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)

Sign In for Pricing
View Details
Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)
TMPH-00671-05 100 µg

Major curlin subunit Protein, E. coli O157:H7, Recombinant (His)

Sign In for Pricing
View Details