Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5)

This Recombinant Human Interferon-induced transmembrane protein 5 (IFITM5) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 5, Bone-restricted interferon-induced transmembrane protein-like protein, BRIL

UniProt

A6NNB3

Expression Region

1-132

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA FFSTKFDDADYD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOLEDO Cell Line
CL-0894 1x 10^6 Cells/Vial - 2 Vials

TOLEDO Cell Line

Sign In for Pricing
View Details
Mycoplasma genitalium Antibody
abx022093 1 mg

Mycoplasma genitalium Antibody

Sign In for Pricing
View Details
Vav1 (BC020487) Mouse Tagged ORF Clone
MG210763 10 µg

Vav1 (BC020487) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Clavispora lusitaniae Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)
MBS1264741 Inquire

Recombinant Clavispora lusitaniae Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

Sign In for Pricing
View Details
MMP-2 Rabbit Polyclonal Antibody (PE-Cy5)
orb877717 100 µL

MMP-2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Trappc3l (NM_001162937) Mouse Tagged ORF Clone
MG217001 10 µg

Trappc3l (NM_001162937) Mouse Tagged ORF Clone

Sign In for Pricing
View Details