Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ComG operon protein 4 (comGD)

This Recombinant Bacillus subtilis ComG operon protein 4 (comGD) spans the amino acid sequence from region 11-143.

Product Specifications

Product Name Alternative

ComG operon protein 4

UniProt

P25956

Expression Region

11-143

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FTLLESLLVLSLASILLVAVFTTLPPAYDNTAVRQAASQLKNDIMLTQQTAISRQQRTKI LFHKKEYQLVIGDTVIERPYATGLSIELLTLKDRLEFNEKGHPNAGGKIRVKGHAVYDIT VYLGSGRVNVERK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Equine herpesvirus 2 Gene 55 protein (55)
MBS1352983-01 0.02 mg (E-Coli)

Recombinant Equine herpesvirus 2 Gene 55 protein (55)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 2 Gene 55 protein (55)
MBS1352983-02 0.1 mg (E-Coli)

Recombinant Equine herpesvirus 2 Gene 55 protein (55)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 2 Gene 55 protein (55)
MBS1352983-03 0.02 mg (Yeast)

Recombinant Equine herpesvirus 2 Gene 55 protein (55)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 2 Gene 55 protein (55)
MBS1352983-04 0.1 mg (Yeast)

Recombinant Equine herpesvirus 2 Gene 55 protein (55)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 2 Gene 55 protein (55)
MBS1352983-05 0.02 mg (Baculovirus)

Recombinant Equine herpesvirus 2 Gene 55 protein (55)

Sign In for Pricing
View Details
Recombinant Equine herpesvirus 2 Gene 55 protein (55)
MBS1352983-06 0.02 mg (Mammalian-Cell)

Recombinant Equine herpesvirus 2 Gene 55 protein (55)

Sign In for Pricing
View Details