Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorobium phaeobacteroides Large-conductance mechanosensitive channel (mscL)

This Recombinant Chlorobium phaeobacteroides Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B3EL80

Expression Region

1-133

Origin

Chlorobium phaeobacteroides (strain BS1)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVMKEFKEFAVKGNVVDMAVGIVIGAAFGKIVTAFVDGVLMPPIGLMLGGVNFNELALI LQEATGEAEAVMINYGIFVQTLVDFIIIAFAIFLVVRGINSLKRKEEAPKTPPGPSKEEL LLGEIRDLLKQRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-100 1x 100 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-100 1x 100 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF568 conjugate, 0.1mg/mL
BNC680416-500 1x 500 µL

Fascin-1 (FSCN1/416), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), Biotin conjugate, 0.1mg/mL
BNCB0324-500 1x 500 µL

CD53 (161-2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details