Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Synechococcus sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q5N075

Expression Region

1-133

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRRGRAVGFIRDFQAFILKGNVVELAVAVIIGGAFNKIVSSFVGDLVMPLVNPLIPGG DWRTAVIGPGLKIGSFAGSVIDFLIIAFVLYLAIRAIERFKRKEEAVVAAAEPDVQQQML ATLERIADNLEAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF594 conjugate, 0.1mg/mL
BNC940747-500 1x 500 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Azurocidin (AZU1) (NM_001700) Human Over-expression Lysate
LC419800 20 µg

Azurocidin (AZU1) (NM_001700) Human Over-expression Lysate

Sign In for Pricing
View Details
Gradient Thermal Cycler BTHC-102
BTHC-102 Each

Gradient Thermal Cycler BTHC-102

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS808778 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Anti-Mouse CTLA-4 (UC10-4F10-11) In Vivo Antibody - Low Endotoxin
ICH1085-100mg 100 mg

Anti-Mouse CTLA-4 (UC10-4F10-11) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
ALDH2 Recombinant Mouse Monoclonal Antibody [E4-D10-R]
HA601175 100 µL

ALDH2 Recombinant Mouse Monoclonal Antibody [E4-D10-R]

Sign In for Pricing
View Details