Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Synechococcus sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q5N075

Expression Region

1-133

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRRGRAVGFIRDFQAFILKGNVVELAVAVIIGGAFNKIVSSFVGDLVMPLVNPLIPGG DWRTAVIGPGLKIGSFAGSVIDFLIIAFVLYLAIRAIERFKRKEEAVVAAAEPDVQQQML ATLERIADNLEAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHF11 Rabbit Polyclonal Antibody
HA500478 100 µL

PHF11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tm6sf1 Mouse Gene Knockout Kit (CRISPR)
KN517644 1 Kit

Tm6sf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NTN3 Human Gene Knockout Kit (CRISPR)
KN424259 1 Kit

NTN3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human eRF1 (ETF1) activation kit by CRISPRa
GA101466 1 Kit

Human eRF1 (ETF1) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS709670 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
BOD Incubator BIBD-201
BIBD-201 1 Unit

BOD Incubator BIBD-201

Sign In for Pricing
View Details