Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Synechococcus sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q5N075

Expression Region

1-133

Origin

Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRRGRAVGFIRDFQAFILKGNVVELAVAVIIGGAFNKIVSSFVGDLVMPLVNPLIPGG DWRTAVIGPGLKIGSFAGSVIDFLIIAFVLYLAIRAIERFKRKEEAVVAAAEPDVQQQML ATLERIADNLEAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6V1 Human Gene Knockout Kit (CRISPR)
KN418286 1 Kit

OR6V1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD39 Recombinant Rabbit Monoclonal Antibody [JA90-36]
ET1704-74 100 µL

CD39 Recombinant Rabbit Monoclonal Antibody [JA90-36]

Sign In for Pricing
View Details
R-Benzbromarone
TRC-B185210-100MG 100 mg

R-Benzbromarone

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD74 Antibody[LN2]
E-AB-F1072I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD74 Antibody[LN2]
E-AB-F1072I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD74 Antibody[LN2]
E-AB-F1072I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Human CD74 Antibody[LN2]

Sign In for Pricing
View Details