Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4)

This Recombinant Chicken NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 (NDUFB4) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, Complex I-B15, CI-B15, GGHPW, NADH-ubiquinone oxidoreductase B15 subunit, Protein Walter

UniProt

P48306

Expression Region

1-133

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGPSRTAAEEYRPNRYVSLPAELDPATYDTPLEKRRAEAERLAIRARLKRQYLLQLNT PKPPRVIEDPALLRWDYARTHNVYPTFRPTPKTSFLGAVFAIGPILFWIAAFKTERVSSA GGVEHQGAPGCKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details