Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome b5 (Cyb5a)

This Recombinant Mouse Cytochrome b5 (Cyb5a) spans the amino acid sequence from region 2-134.

Product Specifications

Product Name Alternative

Cytochrome b5

UniProt

P56395

Expression Region

2-134

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSDTLITTVESNSSWWTNWVIPAISAL AVALMYRLYMAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PACSIN2 antibody
FNab06101 100 µg

PACSIN2 antibody

Sign In for Pricing
View Details
Anti Human Amyloid Beta A4 Protein APP Mab
181393 100 µg

Anti Human Amyloid Beta A4 Protein APP Mab

Sign In for Pricing
View Details
IFN-γRα (phospho Tyr457) Polyclonal Antibody
UB-GEN-12858 100 µL

IFN-γRα (phospho Tyr457) Polyclonal Antibody

Sign In for Pricing
View Details
hsa-miR-7110-5p miRNA Inhibitor
MBS8295263-01 10 nmol

hsa-miR-7110-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-7110-5p miRNA Inhibitor
MBS8295263-02 20 nmol

hsa-miR-7110-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-7110-5p miRNA Inhibitor
MBS8295263-03 5x 20 nmol

hsa-miR-7110-5p miRNA Inhibitor

Sign In for Pricing
View Details