Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b5 (CYB5A)

This Recombinant Human Cytochrome b5 (CYB5A) spans the amino acid sequence from region 2-134.

Product Specifications

Product Name Alternative

Cytochrome b5, Microsomal cytochrome b5 type A, MCB5

UniProt

P00167

Expression Region

2-134

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAV AVALMYRLYMAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (NM_000611) Human Recombinant Protein
TP318343M 100 µg

CD59 (NM_000611) Human Recombinant Protein

Sign In for Pricing
View Details
PDGFR (Beta-type platelet-derived growth factor receptor,PDGFRB,) (Biotin)
MBS6121224-01 0.2 mL

PDGFR (Beta-type platelet-derived growth factor receptor,PDGFRB,) (Biotin)

Sign In for Pricing
View Details
PDGFR (Beta-type platelet-derived growth factor receptor,PDGFRB,) (Biotin)
MBS6121224-02 5x 0.2 mL

PDGFR (Beta-type platelet-derived growth factor receptor,PDGFRB,) (Biotin)

Sign In for Pricing
View Details
Sheep Kidney and Brain Protein ELISA Kit
MBS062733-01 48 Well

Sheep Kidney and Brain Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Kidney and Brain Protein ELISA Kit
MBS062733-02 96 Well

Sheep Kidney and Brain Protein ELISA Kit

Sign In for Pricing
View Details
Sheep Kidney and Brain Protein ELISA Kit
MBS062733-03 5x 96 Well

Sheep Kidney and Brain Protein ELISA Kit

Sign In for Pricing
View Details