Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Cytochrome b5 (CYB5A)

This Recombinant Rabbit Cytochrome b5 (CYB5A) spans the amino acid sequence from region 2-134.

Product Specifications

Product Name Alternative

Cytochrome b5

UniProt

P00169

Expression Region

2-134

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAQSDKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTFIIGELHPDDRSKLSKPMETLITTVDSNSSWWTNWVIPAISAL IVALMYRLYMADD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Acetyl Coenzyme A ELISA Kit
GTR10367177 96 Well

Mouse Acetyl Coenzyme A ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal TBC1D28 Antibody (OTI4A9) [Dylight 594]
NBP2-74461DL594 0.1 mL

Mouse Monoclonal TBC1D28 Antibody (OTI4A9) [Dylight 594]

Sign In for Pricing
View Details
Mipol1 (NM_001164370) Mouse Recombinant Protein
PM42906M5 20 µg

Mipol1 (NM_001164370) Mouse Recombinant Protein

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Human shRNA Lentiviral Particle (Locus ID 5156)
TL310535V 500 µL Each

PDGF Receptor alpha (PDGFRA) Human shRNA Lentiviral Particle (Locus ID 5156)

Sign In for Pricing
View Details
CCL18 Antibody
GWB-D4385A 0.05 mg

CCL18 Antibody

Sign In for Pricing
View Details
GAS2L1 (NM_006478) Human Tagged ORF Clone Lentiviral Particle
RC203825L4V 200 µL

GAS2L1 (NM_006478) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details