Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Cytochrome b5 (CYB5A)

This Recombinant Rabbit Cytochrome b5 (CYB5A) spans the amino acid sequence from region 2-134.

Product Specifications

Product Name Alternative

Cytochrome b5

UniProt

P00169

Expression Region

2-134

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAQSDKDVKYYTLEEIKKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTFIIGELHPDDRSKLSKPMETLITTVDSNSSWWTNWVIPAISAL IVALMYRLYMADD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF2K (Ab-359) Antibody
8B8340-AAT 50 µg

EEF2K (Ab-359) Antibody

Sign In for Pricing
View Details
L1CAM Antibody
MBS9405010-01 0.1 mL

L1CAM Antibody

Sign In for Pricing
View Details
L1CAM Antibody
MBS9405010-02 5x 0.1 mL

L1CAM Antibody

Sign In for Pricing
View Details
Mouse Heat Shock Protein Beta-2,HSPb2 ELISA KIT
JOT-EK0878Mo-01 96 Well

Mouse Heat Shock Protein Beta-2,HSPb2 ELISA KIT

Sign In for Pricing
View Details
Mouse Heat Shock Protein Beta-2,HSPb2 ELISA KIT
JOT-EK0878Mo-02 48 Well

Mouse Heat Shock Protein Beta-2,HSPb2 ELISA KIT

Sign In for Pricing
View Details
AP3B2 Rabbit pAb
A13808 50 µL

AP3B2 Rabbit pAb

Sign In for Pricing
View Details