Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b5 (Cyb5a)

This Recombinant Rat Cytochrome b5 (Cyb5a) spans the amino acid sequence from region 2-134.

Product Specifications

Product Name Alternative

Cytochrome b5

UniProt

P00173

Expression Region

2-134

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISAL VVALMYRLYMAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM166B (NM_001099951) Human Over-expression Lysate
LY420215 100 µg

FAM166B (NM_001099951) Human Over-expression Lysate

Sign In for Pricing
View Details
3-(4-Chloro-5H-pyrrolo[2,3-d]pyrimidin-7(6H)-yl)-3-oxopropanenitrile
TRC-C588090-500MG 500 mg

3-(4-Chloro-5H-pyrrolo[2,3-d]pyrimidin-7(6H)-yl)-3-oxopropanenitrile

Sign In for Pricing
View Details
Rovalpituzumab Biosimilar - Research Grade
ICH5048-10mg 10 mg (2x 5 mg)

Rovalpituzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
OVGP1 (N-term) Rabbit Polyclonal Antibody
AP23959PU-N 50 µg

OVGP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dispensing Booth BAIP-103
BAIP-103 1 Unit

Dispensing Booth BAIP-103

Sign In for Pricing
View Details
EMR2 (ADGRE2) Rabbit Polyclonal Antibody
AP01298PU-N 100 µg

EMR2 (ADGRE2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details