Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b5 (Cyb5a)

This Recombinant Rat Cytochrome b5 (Cyb5a) spans the amino acid sequence from region 2-134.

Product Specifications

Product Name Alternative

Cytochrome b5

UniProt

P00173

Expression Region

2-134

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISAL VVALMYRLYMAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JM4 (PRAF2) (NM_007213) Human Over-expression Lysate
LY402110 100 µg

JM4 (PRAF2) (NM_007213) Human Over-expression Lysate

Sign In for Pricing
View Details
QuicKey Pro Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit
E-OSEL-H0018-01 24 Tests

QuicKey Pro Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit
E-OSEL-H0018-02 48 Tests

QuicKey Pro Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit
E-OSEL-H0018-03 96 Tests

QuicKey Pro Human ICAM-1/CD54 (intercellular adhesion molecule 1) ELISA Kit

Sign In for Pricing
View Details
Human Endometrial Adenocarcinoma CAFs
CAF01 1000000 Cells

Human Endometrial Adenocarcinoma CAFs

Sign In for Pricing
View Details
TNF-alpha (Tumor Necrosis Factor alpha), Biotin conjugate, 0.1mg/mL
BNCB1674-100 1x 100 µL

TNF-alpha (Tumor Necrosis Factor alpha), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details