Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yqjE (yqjE)

This Recombinant Inner membrane protein yqjE (yqjE) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Inner membrane protein yqjE

UniProt

P64587

Expression Region

1-134

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTHHAQGPGKSVLGIGQRIVSIMVEMVETRLRLAVVELEEEKANLFQLLLMLGLTMLF AAFGLMSLMVLIIWAVDPQYRLNAMIATTVVLLLLALIGGIWTLRKSRKSTLLRHTRHEL ANDRQLLEEESREQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGER4 (Prostaglandin E2 Receptor EP4 Subtype, PGE2 Receptor EP4 Subtype, PGE Receptor EP4 Subtype, Prostaglandin E Receptor 4, Subtype EP4, EP4, EP4R, MGC126583, Prostanoid EP4 Receptor) (APC)
132020-APC 100 µL

PTGER4 (Prostaglandin E2 Receptor EP4 Subtype, PGE2 Receptor EP4 Subtype, PGE Receptor EP4 Subtype, Prostaglandin E Receptor 4, Subtype EP4, EP4, EP4R, MGC126583, Prostanoid EP4 Receptor) (APC)

Sign In for Pricing
View Details
Ktn1 (NM_008477) Mouse Tagged Lenti ORF Clone
MR224535L4 10 µg

Ktn1 (NM_008477) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (MaxLight 405)
MBS6366431-01 0.1 mL

ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (MaxLight 405)

Sign In for Pricing
View Details
ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (MaxLight 405)
MBS6366431-02 5x 0.1 mL

ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (MaxLight 405)

Sign In for Pricing
View Details
MED19 Adenovirus (Mouse)
28303054 1.0 mL

MED19 Adenovirus (Mouse)

Sign In for Pricing
View Details
Nori® Monkey 2-Plex ELISA Kits-MyBPC3/GPBB
GR240102 96 Well

Nori® Monkey 2-Plex ELISA Kits-MyBPC3/GPBB

Sign In for Pricing
View Details