Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yqjE (yqjE)

This Recombinant Inner membrane protein yqjE (yqjE) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Inner membrane protein yqjE

UniProt

P64587

Expression Region

1-134

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADTHHAQGPGKSVLGIGQRIVSIMVEMVETRLRLAVVELEEEKANLFQLLLMLGLTMLF AAFGLMSLMVLIIWAVDPQYRLNAMIATTVVLLLLALIGGIWTLRKSRKSTLLRHTRHEL ANDRQLLEEESREQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal mPlum Antibody [DyLight 680]
NBP3-11833FR 0.1 mL

Rabbit Polyclonal mPlum Antibody [DyLight 680]

Sign In for Pricing
View Details
Human NRF1 Recombinant Protein
PPT-14289 100 µg

Human NRF1 Recombinant Protein

Sign In for Pricing
View Details
Rat Ccr5 / C-C chemokine receptor type 5 Recombinant Protein
R2055r 1 Each

Rat Ccr5 / C-C chemokine receptor type 5 Recombinant Protein

Sign In for Pricing
View Details
Rak shRNA (m) Lentiviral Particles
sc-39232-V 200 µL

Rak shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
LOC552889, ID (ATXN7L3B, Putative ataxin-7-like protein 3B) (MaxLight 650)
MBS6316688-01 0.1 mL

LOC552889, ID (ATXN7L3B, Putative ataxin-7-like protein 3B) (MaxLight 650)

Sign In for Pricing
View Details
LOC552889, ID (ATXN7L3B, Putative ataxin-7-like protein 3B) (MaxLight 650)
MBS6316688-02 5x 0.1 mL

LOC552889, ID (ATXN7L3B, Putative ataxin-7-like protein 3B) (MaxLight 650)

Sign In for Pricing
View Details