Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xylella fastidiosa Large-conductance mechanosensitive channel (mscL)

This Recombinant Xylella fastidiosa Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B2I658

Expression Region

1-134

Origin

Xylella fastidiosa (strain M23)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIREFKEFVMRGNVIDLAVAVVIGAAFGKIVTALVDKIISPLIGVMVGGIDFSKLSLT LKAATVDTAGKEVPAVVIGYGDFINTILQFIIIAFAIFIIVKMINKVINKQPLPPETPSE DVLLLREIRDSLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-100 1x 100 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-100 1x 100 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX6 (PAX6/1166), CF640R conjugate, 0.1mg/mL
BNC401166-500 1x 500 µL

PAX6 (PAX6/1166), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details