Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ytkC (ytkC)

This Recombinant Bacillus subtilis Uncharacterized protein ytkC (ytkC) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Uncharacterized protein ytkC

UniProt

O34883

Expression Region

1-134

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRDFGIFSFLAVSVSAAGFFFGGFQYSFLILLSLMAIEFISTTLKETIIHKLSFKKVFA RLVKKLVTLALISVCHFFDQLLNTQGSIRDLAIMFYILYESVQIVVTASSLGIPVPQMLV DLLETLKNKFKRKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRR5-ARHGAP8 Knockout HEK293T cell line
GTR15407792 1 Vial

Human PRR5-ARHGAP8 Knockout HEK293T cell line

Sign In for Pricing
View Details
AP1S1 Adenovirus (Human)
12103051 1.0 mL

AP1S1 Adenovirus (Human)

Sign In for Pricing
View Details
CD318 (pT707) Antibody
abx009759-01 30 µL

CD318 (pT707) Antibody

Sign In for Pricing
View Details
CD318 (pT707) Antibody
abx009759-02 100 µL

CD318 (pT707) Antibody

Sign In for Pricing
View Details
CD318 (pT707) Antibody
abx009759-03 200 µL

CD318 (pT707) Antibody

Sign In for Pricing
View Details
Lag3 Mouse siRNA Oligo Duplex (Locus ID 16768)
SR416613 1 Kit

Lag3 Mouse siRNA Oligo Duplex (Locus ID 16768)

Sign In for Pricing
View Details