Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 100 (TMEM100)

This Recombinant Human Transmembrane protein 100 (TMEM100) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Transmembrane protein 100

UniProt

Q9NV29

Expression Region

1-134

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPF AVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRE SQTALVANQRSLFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD300LD-AS1 Human qPCR Primer Pair (NM_152460)
HP217721 200 Reactions

CD300LD-AS1 Human qPCR Primer Pair (NM_152460)

Sign In for Pricing
View Details
Mouse Protein Wiz (WIZ) ELISA Kit
abx553597 96 Tests

Mouse Protein Wiz (WIZ) ELISA Kit

Sign In for Pricing
View Details
ASPHD1 Lentiviral Activation Particles (h)
sc-415187-LAC 200 µL

ASPHD1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Stard5 3'UTR GFP Stable Cell Line
TU271275 1.0 mL

Stard5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat matrix metalloproteinase 3 (MMP-3) ELISA Kit
GA-E0324RT-01 48 Tests

Rat matrix metalloproteinase 3 (MMP-3) ELISA Kit

Sign In for Pricing
View Details
Rat matrix metalloproteinase 3 (MMP-3) ELISA Kit
GA-E0324RT-02 96 Tests

Rat matrix metalloproteinase 3 (MMP-3) ELISA Kit

Sign In for Pricing
View Details