Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 100 (TMEM100)

This Recombinant Human Transmembrane protein 100 (TMEM100) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Transmembrane protein 100

UniProt

Q9NV29

Expression Region

1-134

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPF AVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRE SQTALVANQRSLFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-B-Myb Antibody, Affinity Purified
A301-656A 100 µg

Rabbit anti-B-Myb Antibody, Affinity Purified

Sign In for Pricing
View Details
CSN8 HDR Plasmid (m)
sc-430844-HDR 20 µg

CSN8 HDR Plasmid (m)

Sign In for Pricing
View Details
ADSL Double Nickase Plasmid (h2)
sc-404936-NIC-2 20 µg

ADSL Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Vmn1r205 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
49611154 3x 1.0 µg DNA

Vmn1r205 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
MHC Class II Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-4298R-APC-Cy5.5 100 µL

MHC Class II Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Neuroendocrine Regulatory Peptide-1 (human)
H-6622.0500 0.5mg

Neuroendocrine Regulatory Peptide-1 (human)

Sign In for Pricing
View Details