Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 100 (Tmem100)

This Recombinant Mouse Transmembrane protein 100 (Tmem100) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Transmembrane protein 100

UniProt

Q9CQG9

Expression Region

1-134

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPF AVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRE SQTALVVNQRCLFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EWSR1/EWS Recombinant Rabbit Monoclonal Antibody [JE49-57]
ET7109-94 100 µL

EWSR1/EWS Recombinant Rabbit Monoclonal Antibody [JE49-57]

Sign In for Pricing
View Details
IL-8 Rabbit Polyclonal Antibody
ER1706-67 100 µL

IL-8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS808055 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
MyGel Mini Electrophoresis System Starter Kit (Includes E1101-E, A1701 and W4000-100)
E1101-SK-E 1 Each

MyGel Mini Electrophoresis System Starter Kit (Includes E1101-E, A1701 and W4000-100)

Sign In for Pricing
View Details
Recombinant Transferrin Receptor 1 Antibody
RC-4422-01 50 μL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details
Recombinant Transferrin Receptor 1 Antibody
RC-4422-02 100 µL

Recombinant Transferrin Receptor 1 Antibody

Sign In for Pricing
View Details