Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 100 (Tmem100)

This Recombinant Mouse Transmembrane protein 100 (Tmem100) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Transmembrane protein 100

UniProt

Q9CQG9

Expression Region

1-134

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPF AVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRE SQTALVVNQRCLFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Morn5 (NM_029309) Mouse Tagged ORF Clone
MG201422 10 µg

Morn5 (NM_029309) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human ATXN10 activation kit by CRISPRa
GA108555 1 Kit

Human ATXN10 activation kit by CRISPRa

Sign In for Pricing
View Details
LRFN5 (NM_152447) Human Recombinant Protein
TP307383M 100 µg

LRFN5 (NM_152447) Human Recombinant Protein

Sign In for Pricing
View Details
CDY1B Human Gene Knockout Kit (CRISPR)
KN413715 1 Kit

CDY1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, LMW (KRTL/1077), CF488A conjugate, 0.1mg/mL
BNC881077-100 1x 100 µL

Cytokeratin, LMW (KRTL/1077), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium 5-Phenyl-1,3,4-oxadiazole-2-carboxylate
TRC-B526710-1G 1 g

Sodium 5-Phenyl-1,3,4-oxadiazole-2-carboxylate

Sign In for Pricing
View Details