Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 100 (Tmem100)

This Recombinant Mouse Transmembrane protein 100 (Tmem100) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Transmembrane protein 100

UniProt

Q9CQG9

Expression Region

1-134

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEESTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAATGGAELSCYRCIIPF AVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSALCWKVRQRNKKVKRRE SQTALVVNQRCLFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL
BNC742929-100 1x 100 µL

RNA Polymerase II (CTD4H8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FKBP10 Human Gene Knockout Kit (CRISPR)
KN203676RB 1 Kit

FKBP10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Leukotriene A4 Hydrolase Antibody
OC-590-01 50 μL

Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Leukotriene A4 Hydrolase Antibody
OC-590-02 100 µL

Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
Leukotriene A4 Hydrolase Antibody
OC-590-03 1 mL

Leukotriene A4 Hydrolase Antibody

Sign In for Pricing
View Details
SH3PX1 (SNX9) (NM_016224) Human Over-expression Lysate
LY402520 100 µg

SH3PX1 (SNX9) (NM_016224) Human Over-expression Lysate

Sign In for Pricing
View Details