Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus phage Cp-1 Holin (CPH1)

This Recombinant Streptococcus phage Cp-1 Holin (CPH1) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Holin, Lysis protein

UniProt

Q38008

Expression Region

1-134

Origin

Streptococcus phage Cp-1 (Bacteriophage Cp-1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYNIMLEVAKGDYITILFALILFDFITGFLKAWKWKVTDSWTGLKGVIKHTLTFIFYYF VAVFLTYIHAMAVGQILLVIINLYYALSIMENLAVMGVFIPKFMTARVQEELQKYTAQLD AGKDLLEEFKGEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human BDNF Protein, N-His
orb3062076-01 50 µg

Recombinant Human BDNF Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BDNF Protein, N-His
orb3062076-02 100 µg

Recombinant Human BDNF Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BDNF Protein, N-His
orb3062076-03 1 mg

Recombinant Human BDNF Protein, N-His

Sign In for Pricing
View Details
SCN2B (NM_004588) Human Tagged ORF Clone
RC207778 10 µg

SCN2B (NM_004588) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human ATF1, GST-tagged
ATF1-9960H 25 µg

Recombinant Human ATF1, GST-tagged

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi C Ribosome maturation factor RimP (rimP)
MBS1055204-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi C Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details