Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus phage Cp-1 Holin (CPH1)

This Recombinant Streptococcus phage Cp-1 Holin (CPH1) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Holin, Lysis protein

UniProt

Q38008

Expression Region

1-134

Origin

Streptococcus phage Cp-1 (Bacteriophage Cp-1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYNIMLEVAKGDYITILFALILFDFITGFLKAWKWKVTDSWTGLKGVIKHTLTFIFYYF VAVFLTYIHAMAVGQILLVIINLYYALSIMENLAVMGVFIPKFMTARVQEELQKYTAQLD AGKDLLEEFKGEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Visinin like protein 1 (VSNL1) ELISA Kit
GTR10339568 96 Well

Canine Visinin like protein 1 (VSNL1) ELISA Kit

Sign In for Pricing
View Details
MAPK10 3'UTR Luciferase Stable Cell Line
TU012994 1.0 mL

MAPK10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Camel Secretogranin II ELISA Kit
MBS097669-01 48 Well

Camel Secretogranin II ELISA Kit

Sign In for Pricing
View Details
Camel Secretogranin II ELISA Kit
MBS097669-02 96 Well

Camel Secretogranin II ELISA Kit

Sign In for Pricing
View Details
Camel Secretogranin II ELISA Kit
MBS097669-03 5x 96 Well

Camel Secretogranin II ELISA Kit

Sign In for Pricing
View Details
Camel Secretogranin II ELISA Kit
MBS097669-04 10x 96 Well

Camel Secretogranin II ELISA Kit

Sign In for Pricing
View Details