Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hippocampus abundant transcript-like protein 2 (HIATL2)

This Recombinant Human Hippocampus abundant transcript-like protein 2 (HIATL2) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Hippocampus abundant transcript-like protein 2

UniProt

Q5VZR4

Expression Region

1-134

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVEPPPELEEKAASEPEAGAMPEKRAGAQAAGSTWLQGFGPPSVYHAAIVIFLEFFAWG LLTTPMLTVLHETFSQHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKPFLLGTVFFT CFPIPLMRISPCQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAM (Signal Transducing Adaptor Molecules, STAM1, STAM-1) (MaxLight 550)
MBS6439076-01 0.1 mL

STAM (Signal Transducing Adaptor Molecules, STAM1, STAM-1) (MaxLight 550)

Sign In for Pricing
View Details
STAM (Signal Transducing Adaptor Molecules, STAM1, STAM-1) (MaxLight 550)
MBS6439076-02 5x 0.1 mL

STAM (Signal Transducing Adaptor Molecules, STAM1, STAM-1) (MaxLight 550)

Sign In for Pricing
View Details
Atxn2l ORF Vector (Mouse) (pORF)
ORF039403 1.0 µg DNA

Atxn2l ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CCAAT/enhancer-binding protein beta
AP82140 1 mg

CCAAT/enhancer-binding protein beta

Sign In for Pricing
View Details
FCGBP Polyclonal Antibody
BS65748-01 50 µL

FCGBP Polyclonal Antibody

Sign In for Pricing
View Details
FCGBP Polyclonal Antibody
BS65748-02 100 µL

FCGBP Polyclonal Antibody

Sign In for Pricing
View Details