Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Hippocampus abundant transcript-like protein 2 (HIATL2)

This Recombinant Human Hippocampus abundant transcript-like protein 2 (HIATL2) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Hippocampus abundant transcript-like protein 2

UniProt

Q5VZR4

Expression Region

1-134

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVEPPPELEEKAASEPEAGAMPEKRAGAQAAGSTWLQGFGPPSVYHAAIVIFLEFFAWG LLTTPMLTVLHETFSQHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKPFLLGTVFFT CFPIPLMRISPCQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IBRDC2 (E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein, RNF144B, P53RFP)
MBS6005897-01 0.05 mg

IBRDC2 (E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein, RNF144B, P53RFP)

Sign In for Pricing
View Details
IBRDC2 (E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein, RNF144B, P53RFP)
MBS6005897-02 5x 0.05 mg

IBRDC2 (E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein, RNF144B, P53RFP)

Sign In for Pricing
View Details
Rabbit Monoclonal E-Selectin/CD62E Antibody (208) [Alexa Fluor 405]
NBP2-89432AF405 0.1 mL

Rabbit Monoclonal E-Selectin/CD62E Antibody (208) [Alexa Fluor 405]

Sign In for Pricing
View Details
2-Cyano-5-fluorobenzoic acid
PC5925 1 Each

2-Cyano-5-fluorobenzoic acid

Sign In for Pricing
View Details
SEC61B, ID (SEC61B, Protein transport protein Sec61 subunit beta)
041519 200 µL

SEC61B, ID (SEC61B, Protein transport protein Sec61 subunit beta)

Sign In for Pricing
View Details
LEPROT CRISPR All-in-one AAV vector set (with saCas9)(Human)
26450151 3x 1.0 µg DNA

LEPROT CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details