Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfur-rich protein (srp)

This Recombinant Sulfur-rich protein (srp) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Sulfur-rich protein

UniProt

Q9AIS6

Expression Region

1-134

Origin

Chlamydophila abortus

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRA FQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEK WRLCKRLLQQLKIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPCAT1 (NM_024830) Human Over-expression Lysate
E45H17514-2 20 µg

LPCAT1 (NM_024830) Human Over-expression Lysate

Sign In for Pricing
View Details
Sulfo-NHS-Biotin Kit
K1005-10 10 Reactions

Sulfo-NHS-Biotin Kit

Sign In for Pricing
View Details
Rabbit Polyclonal OBFC2A Antibody [DyLight 550]
NBP1-26640R 0.1 mL

Rabbit Polyclonal OBFC2A Antibody [DyLight 550]

Sign In for Pricing
View Details
N-nitroso desmethyl-eravacycline
CS-O-49880-10MG 1 Each

N-nitroso desmethyl-eravacycline

Sign In for Pricing
View Details
Anti-OCTN2 antibody
STJ94600 200 µl

Anti-OCTN2 antibody

Sign In for Pricing
View Details
TARC/CCL17 Protein, Human, Recombinant (His)
TMPY-02061-01 5 µg

TARC/CCL17 Protein, Human, Recombinant (His)

Sign In for Pricing
View Details