Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfur-rich protein (srp)

This Recombinant Sulfur-rich protein (srp) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Sulfur-rich protein

UniProt

Q9AIS6

Expression Region

1-134

Origin

Chlamydophila abortus

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRA FQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEK WRLCKRLLQQLKIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PABPC5 (C-Term) Rabbit pAb
E2619327 100 µL

PABPC5 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody (Biotin)
KB-26808-01 50 μL

Repulsive guidance molecule A Antibody (Biotin)

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody (Biotin)
KB-26808-02 100 µL

Repulsive guidance molecule A Antibody (Biotin)

Sign In for Pricing
View Details
Repulsive guidance molecule A Antibody (Biotin)
KB-26808-03 1 mL

Repulsive guidance molecule A Antibody (Biotin)

Sign In for Pricing
View Details
SLFN14 (NM_001129820) Human Tagged ORF Clone Lentiviral Particle
RC226257L4V 200 µL

SLFN14 (NM_001129820) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-6X His - 50nm Gold Conjugate
AC-50-21-15 1 mL

Anti-6X His - 50nm Gold Conjugate

Sign In for Pricing
View Details