Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfur-rich protein (srp)

This Recombinant Sulfur-rich protein (srp) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Sulfur-rich protein

UniProt

Q9AIS6

Expression Region

1-134

Origin

Chlamydophila abortus

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGESTNSVGNDITSLIQPGLDQVIQDEGVQVTLINSILGWCRIHIINPVKSSKIVKSRA FQITMIVLGIILLIAGLALTFVLQGQLGNNAFLFLIPAVIGLVKLLATSVFMEKPCTPEK WRLCKRLLQQLKIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-425-3p miRNA Antagomir
abx888047-01 10 nmol

Mouse mmu-miR-425-3p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-425-3p miRNA Antagomir
abx888047-02 20 nmol

Mouse mmu-miR-425-3p miRNA Antagomir

Sign In for Pricing
View Details
Exog sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3582803 1.0 µg DNA

Exog sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CD40 Antibody
R35109-100UG 100 µg

CD40 Antibody

Sign In for Pricing
View Details
GALNTL6 siRNA (Human)
orb1849940-01 15 nmol

GALNTL6 siRNA (Human)

Sign In for Pricing
View Details
GALNTL6 siRNA (Human)
orb1849940-02 30 nmol

GALNTL6 siRNA (Human)

Sign In for Pricing
View Details