Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Leukocyte cell-derived chemotaxin 1 (LECT1)

This Recombinant Chicken Leukocyte cell-derived chemotaxin 1 (LECT1) spans the amino acid sequence from region 214-347.

Product Specifications

Product Name Alternative

Leukocyte cell-derived chemotaxin 1, Cleaved into the following 2 chains:, 1. Chondrosurfactant protein, 2. CH-SP, 3. Chondromodulin-1, Chondromodulin-I, ChM-I

UniProt

Q9PUU8

Expression Region

214-347

Origin

Gallus gallus (Chicken)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EMKRNKRQSESNFDAEHRAAAAEEVNTRSTPTQLTQDLGPQSNETRPMQQESDQTLNPDN PYNQLEGEGMAFDPMLDHLGVCCIECRRSYTQCQRICEPLLGYYPWPYNYQGCRTACRII MPCSWWVARIMGVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-100 1x 100 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF488A conjugate, 0.1mg/mL
BNC881052-500 1x 500 µL

CD3e (B-B12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL
BNC402897-100 1x 100 µL

Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details