Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q9PHA5

Expression Region

1-134

Origin

Xylella fastidiosa

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIREFKEFVMRGNVIDLAVAVVIGAAFGKIVTALVDKIISPLIGVMVGGIDFSKLSLT LKAATVDAAGKEVPAVVIGYGDFLNTILQFIIIAFAIFIIVKMINKVINKQPLPPETPSE DVLLLREIRDSLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC mu (PRKD1) Rabbit Polyclonal Antibody
AP06567PU-N 100 µg

PKC mu (PRKD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPA2 Antibody
KC-7655-01 50 μL

CPA2 Antibody

Sign In for Pricing
View Details
CPA2 Antibody
KC-7655-02 100 µL

CPA2 Antibody

Sign In for Pricing
View Details
CPA2 Antibody
KC-7655-03 1 mL

CPA2 Antibody

Sign In for Pricing
View Details
Acid Red 35
TRC-A795288-25MG 25 mg

Acid Red 35

Sign In for Pricing
View Details
HPCAL1 Polyclonal Antibody
E-AB-19154-01 20 µL

HPCAL1 Polyclonal Antibody

Sign In for Pricing
View Details