Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Large-conductance mechanosensitive channel (mscL)

This Recombinant Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q9PHA5

Expression Region

1-134

Origin

Xylella fastidiosa

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFIREFKEFVMRGNVIDLAVAVVIGAAFGKIVTALVDKIISPLIGVMVGGIDFSKLSLT LKAATVDAAGKEVPAVVIGYGDFLNTILQFIIIAFAIFIIVKMINKVINKQPLPPETPSE DVLLLREIRDSLKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ExoBriteTM 410/450 CD9 (Mouse) Flow Antibody (25 tests)
P018-410-125 1x 125 µL

ExoBriteTM 410/450 CD9 (Mouse) Flow Antibody (25 tests)

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF740 conjugate, 0.1mg/mL
BNC741461-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1461), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNF207 (NM_207396) Human Over-expression Lysate
LY404006 100 µg

RNF207 (NM_207396) Human Over-expression Lysate

Sign In for Pricing
View Details
ATF3 (C-term) Rabbit Polyclonal Antibody
AP50284PU-N 400 µL

ATF3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD69 Rabbit Polyclonal Antibody
AP21168PU-N 100 µg

CD69 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Solanum tuberosum Gel -STA- Immobilized Lectin
AK-4701-2 2 mL

Solanum tuberosum Gel -STA- Immobilized Lectin

Sign In for Pricing
View Details