Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorex sadonis Cytochrome b (MT-CYB)

This Recombinant Sorex sadonis Cytochrome b (MT-CYB) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Cytochrome b, Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

UniProt

O21425

Expression Region

1-134

Origin

Sorex sadonis (Sado shrew)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNLRKTHPLMKIINSSFIDLPAPSNISSWWNFGSLLGVCLIIQILTGLFLAMHYTSDTM TAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGLYYGSYMYLETWNIGVLLL FAVMATAFMGYVLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF640R conjugate, 0.1mg/mL
BNC400193-100 1x 100 µL

CD86 (BU63), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF405S conjugate, 0.1mg/mL
BNC041070-100 1x 100 µL

TRAcP (Tartarate Resistant Acid Phosphatase) (ACP5/1070), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF405S conjugate, 0.1mg/mL
BNC042556-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details