Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hordeum vulgare Low molecular mass early light-inducible protein HV90, chloroplastic

This Recombinant Hordeum vulgare Low molecular mass early light-inducible protein HV90, chloroplastic spans the amino acid sequence from region 39-172.

Product Specifications

Product Name Alternative

Low molecular mass early light-inducible protein HV90, chloroplastic, ELIP

UniProt

P14897

Expression Region

39-172

Origin

Hordeum vulgare (Barley)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VRAQTEGPSAPPPNKPKASTSIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLL SQLGSGTGQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVAL AATEIITGAPFINV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NUDT21, N-Twin Strep, C-His, Flag Tag
HA210632-01 20 µg

Human NUDT21, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human NUDT21, N-Twin Strep, C-His, Flag Tag
HA210632-02 50 µg

Human NUDT21, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
Human NUDT21, N-Twin Strep, C-His, Flag Tag
HA210632-03 100 µg

Human NUDT21, N-Twin Strep, C-His, Flag Tag

Sign In for Pricing
View Details
ACO2 Polyclonal Antibody
E-AB-16130-01 20 µL

ACO2 Polyclonal Antibody

Sign In for Pricing
View Details
ACO2 Polyclonal Antibody
E-AB-16130-02 60 µL

ACO2 Polyclonal Antibody

Sign In for Pricing
View Details
ACO2 Polyclonal Antibody
E-AB-16130-03 120 µL

ACO2 Polyclonal Antibody

Sign In for Pricing
View Details