Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aeromonas hydrophila subsp. hydrophila Large-conductance mechanosensitive channel (mscL)

This Recombinant Aeromonas hydrophila subsp. hydrophila Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A0KNB2

Expression Region

1-135

Origin

Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLIQEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVGDVIMPPIGLILGGVDFSDLAVT LKAAEGSTPAVVIAYGKFIQTIIDFLIISFAIFMGLKAINTLKRKQEEEATPAGPTKDQE LLTEIRDLLKSQQGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SMARCD1 Antibody Picoband®, APC Conjugate
A07318-1-APC 100 µg/Vial

Anti-SMARCD1 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Rabbit Polyclonal TTC11 Antibody [PerCP]
NBP2-97168PCP 0.1 mL

Rabbit Polyclonal TTC11 Antibody [PerCP]

Sign In for Pricing
View Details
RNF122 Over-expression Lysate Product
GWB-18085C 0.1 mg

RNF122 Over-expression Lysate Product

Sign In for Pricing
View Details
Dog/Canine Attractin ATM ELISA Kit
BG-CAN10007 1 Each

Dog/Canine Attractin ATM ELISA Kit

Sign In for Pricing
View Details
QDPR (NM_000320) Human Tagged ORF Clone Lentiviral Particle
RC217737L2V 200 µL

QDPR (NM_000320) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PAK4 (6C1)
sc-81532 50 µg - 0.5 mL

PAK4 (6C1)

Sign In for Pricing
View Details