Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0299 membrane protein YPK_2559 (YPK_2559)

This Recombinant Yersinia pseudotuberculosis serotype O:3 UPF0299 membrane protein YPK_2559 (YPK_2559) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

UPF0299 membrane protein YPK_2559

UniProt

B1JPZ3

Expression Region

1-135

Origin

Yersinia pseudotuberculosis serotype O:3 (strain YPIII)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNMMSLCWQYLRAFTIIYLCLWAGKALALLLPIVIPGSIIGMLILFVLLTLQILPSPWV KPSCQLLIRYMALLFVPIGVGVMQYYEQLTKQFGPIVVSCFISTLIVMLVVAYSSHYVHR DRKVISPSTPTEGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-500 1x 500 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF740 conjugate, 0.1mg/mL
BNC741786-100 1x 100 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details