Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides L-alanine exporter AlaE (alaE)

This Recombinant Rhodobacter sphaeroides L-alanine exporter AlaE (alaE) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

L-alanine exporter AlaE

UniProt

Q3IW22

Expression Region

1-135

Origin

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLFIIDTVATVIFFTAVATFSELLIAGMAPSEVLATRLLMVPVMVLTGRPYTRWRDWLV RRTAPRNRWSAFLTDILAFLSFQAPVYGATLLIAGASFAEAGTAIGSAIILMILLARPFG LFVEWTRSLFGVELS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-500 1x 500 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-500 1x 500 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details