Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ygfX (ygfX)

This Recombinant Escherichia coli Uncharacterized protein ygfX (ygfX) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Uncharacterized protein ygfX

UniProt

Q46824

Expression Region

1-135

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRI NARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAE WRDLRRILLQQETQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

epithelial Sodium Channel gamma (SCNN1G) (NM_001039) Human Over-expression Lysate
LY422011 100 µg

epithelial Sodium Channel gamma (SCNN1G) (NM_001039) Human Over-expression Lysate

Sign In for Pricing
View Details
SRY Rabbit Polyclonal Antibody
AP06716PU-N 100 µg

SRY Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gast (NM_010257) Mouse Tagged ORF Clone
MG200311 10 µg

Gast (NM_010257) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein
TP313572 20 µg

ARMETL1 (CDNF) (NM_001029954) Human Recombinant Protein

Sign In for Pricing
View Details
Rat Suppressors Of Cytokine Signaling 3 (SOCS3) ELISA Kit
RDR-SOCS3-Ra-01 96 Tests

Rat Suppressors Of Cytokine Signaling 3 (SOCS3) ELISA Kit

Sign In for Pricing
View Details
Rat Suppressors Of Cytokine Signaling 3 (SOCS3) ELISA Kit
RDR-SOCS3-Ra-02 48 Tests

Rat Suppressors Of Cytokine Signaling 3 (SOCS3) ELISA Kit

Sign In for Pricing
View Details