Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ygfX (ygfX)

This Recombinant Escherichia coli Uncharacterized protein ygfX (ygfX) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Uncharacterized protein ygfX

UniProt

Q46824

Expression Region

1-135

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRI NARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAE WRDLRRILLQQETQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS7 Human qPCR Primer Pair (NM_176824)
HP228673 200 Reactions

BBS7 Human qPCR Primer Pair (NM_176824)

Sign In for Pricing
View Details
ILKAP (NM_030768) Human Over-expression Lysate
LY403076 100 µg

ILKAP (NM_030768) Human Over-expression Lysate

Sign In for Pricing
View Details
(-)-Menthone (contains up to 15% D-Menthone)
TRC-M199550-5G 5 g

(-)-Menthone (contains up to 15% D-Menthone)

Sign In for Pricing
View Details
Replication Protein A2 (RPA2) (RPA2/3140R), 0.2mg/mL
BNUB3140-500 1x 500 µL

Replication Protein A2 (RPA2) (RPA2/3140R), 0.2mg/mL

Sign In for Pricing
View Details
FAM157B (NM_001145249) Human Over-expression Lysate
LY428760 100 µg

FAM157B (NM_001145249) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)
PDMH100106-01 20 µg

Recombinant Human Alpha-Fetoprotein/AFP protein (His tag)

Sign In for Pricing
View Details