Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ygfX (ygfX)

This Recombinant Escherichia coli Uncharacterized protein ygfX (ygfX) spans the amino acid sequence from region 1-135.

Product Specifications

Product Name Alternative

Uncharacterized protein ygfX

UniProt

Q46824

Expression Region

1-135

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRI NARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAE WRDLRRILLQQETQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (C5/473), CF740 conjugate, 0.1mg/mL
BNC740473-100 1x 100 µL

CD5 (C5/473), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS649359 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), Biotin conjugate, 0.1mg/mL
BNCB1860-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gastrin Releasing Peptide (GRP) (NM_001012513) Human Over-expression Lysate
LY422879 100 µg

Gastrin Releasing Peptide (GRP) (NM_001012513) Human Over-expression Lysate

Sign In for Pricing
View Details
Bms1 Mouse Gene Knockout Kit (CRISPR)
KN502207 1 Kit

Bms1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dynamin Inhibitor I, Dynasore
TRC-D826508-10MG 10 mg

Dynamin Inhibitor I, Dynasore

Sign In for Pricing
View Details